NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136640_10425461

Scaffold Ga0136640_10425461


Overview

Basic Information
Taxon OID3300012531 Open in IMG/M
Scaffold IDGa0136640_10425461 Open in IMG/M
Source Dataset NamePolar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ864 (21.06)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)556
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location NameAntarctica: Dry Valley
CoordinatesLat. (o)-78.0767Long. (o)163.8954Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011693Metagenome / Metatranscriptome288Y

Sequences

Protein IDFamilyRBSSequence
Ga0136640_104254611F011693N/ARHTLIALDAIHELRLVHLDLKADNVCIPIGPADFDPAEAPARVLRPRFDDIALIDFAFSLVSGESLRSALPIAAQPDYEYQSPRLLRALEAGRDGDLGPTRQLDWRCDFFSLAAMLWRHLPELDDVAGSAWTTARHRAASAFVSRLVEDHDFDLPQARPHAELIARAAETLRQPDLRLSLQRGWT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.