Scaffold Ga0136637_1084213

Overview

Basic Information

• Taxon OID: 3300012526
• Scaffold ID: Ga0136637_1084213
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ857 (21.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1100
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.0742
  • Long. (^o): 163.7853

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006620	Metagenome / Metatranscriptome	368	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136637_10842133	F006620	GAG	MMPSDPWKDSDPGRGDFDAELAGIDPRYVEAHGGDPNARLRILVSVEGDDAERLERIAYARGQKPGDVVAELLRDADRSVA*