Scaffold Ga0157326_1090827

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0157326_1090827

Scaffold Ga0157326_1090827

Overview

Basic Information
Taxon OID	3300012513 Open in IMG/M
Scaffold ID	Ga0157326_1090827 Open in IMG/M
Source Dataset Name	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	514
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location Name	USA: North Carolina
Coordinates	Lat. (^o)	35.9076	Long. (^o)	-79.0506	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093426	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157326_10908271	F093426	N/A	MGRIPRSKEALHQEARQHIAAVRAFHTGLMAESHKHLHVLATFTRHVEVLRQEGRHVPAKLEAVEACCRELANLRRLRQPWRDTFDDLRHSLIRTRTLFRRLVEASSRKRTRV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.