NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157332_1022536

Scaffold Ga0157332_1022536


Overview

Basic Information
Taxon OID3300012511 Open in IMG/M
Scaffold IDGa0157332_1022536 Open in IMG/M
Source Dataset NameUnplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)745
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9076Long. (o)-79.0506Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F096887Metagenome104N

Sequences

Protein IDFamilyRBSSequence
Ga0157332_10225361F096887N/AMSKNASLAQLNSNGMVLASCLTILSVLLALGIGIRVMLQNDFRILANLRSSTHSFYYSVAGIEWSKNEIAEIDAFPPAPANQTKSFANGAFDVTFSAPAVTGPLTARLTVRSIGTAANAAHIIEAQLMKAYELSDAALAVRGNPARALLSGGEILISGADHDQTNGTARSGAKPRLAISASSELVRELLFQSIEAPEVLDPASLTPAVGQSDYLPVTFVNQLAADVCSVPTASLHPIPMTGS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.