Scaffold Ga0157342_1000755

Overview

Basic Information

• Taxon OID: 3300012507
• Scaffold ID: Ga0157342_1000755
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2146
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044630	Metagenome / Metatranscriptome	154	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157342_10007551	F044630	AGGAGG	MRLATIAAITVLVVLPAGAVQQRYQTASLTPTCDNDGRCTTANAIAPMGPDFIEALESKPSVEAAARRPRSLDANGNSAGGMVISRKTGARARVGVAYAARFQAYIDDLENNHGARVLFMGGIRPGRCSPSSEHPCGKALDVCQLRRGVVDARCNLPGRFTLGQIAAAHGLF