NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157313_1039154

Scaffold Ga0157313_1039154


Overview

Basic Information
Taxon OID3300012503 Open in IMG/M
Scaffold IDGa0157313_1039154 Open in IMG/M
Source Dataset NameArabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)574
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location
Location NameUSA: North Carolina
CoordinatesLat. (o)35.9076Long. (o)-79.0506Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020986Metagenome / Metatranscriptome221Y

Sequences

Protein IDFamilyRBSSequence
Ga0157313_10391543F020986AGGMKTRAITTELDRAFAAARVKGLMGGVVLCDTIAPLYAIHKALKATHASGELTDQQYTEKGRELLEILGNAVVSLFIQQAMRRTRPPR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.