Scaffold Ga0157341_1040239

Overview

Basic Information

• Taxon OID: 3300012494
• Scaffold ID: Ga0157341_1040239
• Source Dataset Name: Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 539
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099723	Metagenome / Metatranscriptome	103	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0157341_10402391	F099723	N/A	PSVLFSPDGGLRVELGSLSQTTKNLLREGITGEYLFILPKYLFESRTNYADVEFLVYLNFFVRYGTRTRIVGTARQRDVLEHLLRLTIFGLFDPHAHEQPSFETLHSLYNVPDRETYALFRMLYEKYGVRQNCCATGAILALDAYIDFVVLDDTARPLLITSSQQGITPHQAAPPEVYS