| Basic Information | |
|---|---|
| Taxon OID | 3300012493 Open in IMG/M |
| Scaffold ID | Ga0157355_1004122 Open in IMG/M |
| Source Dataset Name | Unplanted soil (control) microbial communities from North Carolina - M.Soil.10.yng.090610 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 913 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: North Carolina | |||||||
| Coordinates | Lat. (o) | 35.9076 | Long. (o) | -79.0506 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027687 | Metagenome / Metatranscriptome | 194 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157355_10041221 | F027687 | AGGAGG | MKKMVGFIGLAFLPLMVACSLTARPSQWQPTAVTDFKSVGGKWEGQLIRDNYFTQNYDWATIAIGDTGTCEYAVVRTRTTAQGG |
| ⦗Top⦘ |