Basic Information | |
---|---|
Taxon OID | 3300012487 Open in IMG/M |
Scaffold ID | Ga0157321_1019925 Open in IMG/M |
Source Dataset Name | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 606 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Carolina | |||||||
Coordinates | Lat. (o) | 35.9076 | Long. (o) | -79.0506 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F072056 | Metagenome / Metatranscriptome | 121 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157321_10199251 | F072056 | N/A | ELITWYFLGRIALQFVSLSLVIYLLLNAVVIILYILGMFPTPVHEAPKPPLCTCGKWKYCLRDCPGNSPVRPTNLP* |
⦗Top⦘ |