Scaffold Ga0157333_1014870

Overview

Basic Information

• Taxon OID: 3300012484
• Scaffold ID: Ga0157333_1014870
• Source Dataset Name: Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.old.190510
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 627
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Arabidopsis, Maize, Boechera And Miscanthus Rhizosphere Microbial Communities From Different Us Locations

Source Dataset Sampling Location

• Location Name: USA: North Carolina
• Coordinates
  • Lat. (^o): 35.9076
  • Long. (^o): -79.0506
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006680	Metagenome / Metatranscriptome	367	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157333_10148701	F006680	GGAGG	MKVSKFVWSVVVAFITVASIAPQQVEAIIVDGRVGGNVVFGGSGTITESDGVNSNGIHSNGSNSNVIHELDFNGTLFPHGPLSVTGATDDFLPLVGSQATFNLPIRWTGS