| Basic Information | |
|---|---|
| Taxon OID | 3300012469 Open in IMG/M |
| Scaffold ID | Ga0150984_113565409 Open in IMG/M |
| Source Dataset Name | Combined assembly of Soil carbon rhizosphere |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 650 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Hopland, California, USA | |||||||
| Coordinates | Lat. (o) | 38.97364 | Long. (o) | -123.117453 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F086700 | Metagenome / Metatranscriptome | 110 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0150984_1135654091 | F086700 | GGAG | MAYLEGGLLARSPPSGFTAAFVAVAGSIVLATGIALYTAAPEHQRVNRAAKADALVSSSELKQLALKIPEGDLAGMDEPTMLRAPVGDTDVFNTNQSCLAPEKAVRRFQSEQSVAGGKVVMLAEGLQQSFSDAWRVKTHVTPVKVSNVLAHLFEGPAEQWVADVIEFDANKCAMSRTVVSGADWNALLEAAFGAQA* |
| ⦗Top⦘ |