Basic Information | |
---|---|
Taxon OID | 3300012469 Open in IMG/M |
Scaffold ID | Ga0150984_100427559 Open in IMG/M |
Source Dataset Name | Combined assembly of Soil carbon rhizosphere |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2852 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (20.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hopland, California, USA | |||||||
Coordinates | Lat. (o) | 38.97364 | Long. (o) | -123.117453 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022168 | Metagenome / Metatranscriptome | 215 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0150984_1004275591 | F022168 | N/A | LSSCGERASGEGSGGHVDAETFVEADLKREIASLGELLGDARVRFRHGQTALASLQQLIDVDLEIRNAFRSPLSAALQLEVRSLTARLRALDPR* |
⦗Top⦘ |