Scaffold Ga0150984_100300157

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0150984_100300157

Scaffold Ga0150984_100300157

Overview

Basic Information
Taxon OID	3300012469 Open in IMG/M
Scaffold ID	Ga0150984_100300157 Open in IMG/M
Source Dataset Name	Combined assembly of Soil carbon rhizosphere
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	763
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa, For Root-Enhanced Decomposition Of Organic Matter Studies

Source Dataset Sampling Location
Location Name	Hopland, California, USA
Coordinates	Lat. (^o)	38.97364	Long. (^o)	-123.117453	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073226	Metagenome / Metatranscriptome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0150984_1003001571	F073226	N/A	CGIVAGYWWGYKHSKVHQLTYELERTKLDLAKAKFELEKVSKMQDIHLVKISDIHNNIETVLLKFFDVYRKHSKVVEAADKNVSKNKKEKTKRELDMMWESEFSPLKDQLTQLENTLAELEQREPREFDLLATLPRMLREMKK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.