| Basic Information | |
|---|---|
| Taxon OID | 3300012418 Open in IMG/M |
| Scaffold ID | Ga0138261_1815887 Open in IMG/M |
| Source Dataset Name | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 545 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica | |||||||
| Coordinates | Lat. (o) | -64.775 | Long. (o) | -64.053 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F075564 | Metatranscriptome | 118 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0138261_18158871 | F075564 | N/A | VILKDFYGAAAKEFVQIAASPIDEKGNANGGFDSNYKGSQGSSKAILGLLETIKSDFERTLRNTEAAETKAHEEFTLFDRSSKADIAGKETKTALDKQDLASTISAIDDGMKDLKTASKRLDAALKTIEDLAPTCIDTGMSFKERTQKRQEEMKALEKALCKLDTEKVEADCK* |
| ⦗Top⦘ |