NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0138263_1571844

Scaffold Ga0138263_1571844


Overview

Basic Information
Taxon OID3300012415 Open in IMG/M
Scaffold IDGa0138263_1571844 Open in IMG/M
Source Dataset NameMetatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)633
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition

Source Dataset Sampling Location
Location NameAntarctica
CoordinatesLat. (o)-64.7711Long. (o)-64.056Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020295Metatranscriptome224Y

Sequences

Protein IDFamilyRBSSequence
Ga0138263_15718441F020295N/ALKPFWLKCKFYRYRRRLKTTSKMKVATSLAVFVLFGGVASEMTPMDQTVKLIQGLEKGITADGKSEQESFDAYACWCEKTMERKASDISFGKEVIESTQILIKKLKGEIASHGAEIEQLKRDIAANHKAVKEATDVRDKGNKEYAGDRTESEQCIGAMEAAIKVLTGAGTKAAGFLETMKEAELLSVVAGVRTALKHKVVAQSFNEKDID

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.