Scaffold Ga0138266_1109352

Overview

Basic Information

• Taxon OID: 3300012412
• Scaffold ID: Ga0138266_1109352
• Source Dataset Name: Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA24.B_192.20151118 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1928
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine → Polar Marine Prokaryotic And Eukaryotic Communities From Antarctica During Spring Seasonal Transition

Source Dataset Sampling Location

• Location Name: Antarctica
• Coordinates
  • Lat. (^o): -64.775
  • Long. (^o): -64.053
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029905	Metagenome / Metatranscriptome	187	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0138266_11093521	F029905	N/A	AEVLPLREGRKPRSGFLNAHIKISLSDVRIMILSEYPLSTEEHGHLYYHGDGVDKSFEEAYVWYRIAQCAGNRSVDSIVGHLGSKLVASTCHKLSSRALHIYTRALTH*