| Basic Information | |
|---|---|
| Taxon OID | 3300012411 Open in IMG/M |
| Scaffold ID | Ga0153880_1275779 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 963 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Finland: Tavastia Proper, H?meenlinna, Lake Alinen Mustaj?rvi | |||||||
| Coordinates | Lat. (o) | 61.2 | Long. (o) | 25.1 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F056463 | Metagenome / Metatranscriptome | 137 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153880_12757791 | F056463 | N/A | LTMRELNRKTAGVLDALERGETFELRRNGRAVGCRTQTPPLPERKPDWTAHFEWFKQQRGKGGGFVEALEEDRRRLRAREADMEELG* |
| ⦗Top⦘ |