Scaffold Ga0153880_1175472

Overview

Basic Information

• Taxon OID: 3300012411
• Scaffold ID: Ga0153880_1175472
• Source Dataset Name: Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 599
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Tavastia Proper, H?meenlinna, Lake Alinen Mustaj?rvi
• Coordinates
  • Lat. (^o): 61.2
  • Long. (^o): 25.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072645	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153880_11754722	F072645	N/A	LQNLDGTNTGTLSHAHLLVAEGGGLVALESPAAVMAEVEFRTTHVSMLLTEMFEEAARHDSFWSFDEA*