Scaffold Ga0153880_1142152

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0153880_1142152

Scaffold Ga0153880_1142152

Overview

Basic Information
Taxon OID	3300012411 Open in IMG/M
Scaffold ID	Ga0153880_1142152 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1378
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Finland: Tavastia Proper, H?meenlinna, Lake Alinen Mustaj?rvi
Coordinates	Lat. (^o)	61.2	Long. (^o)	25.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050093	Metagenome / Metatranscriptome	145	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0153880_11421523	F050093	N/A	MTEETTGLLEKELAGVNEQIVRLEKYKTALNVALQARLDLDGFISARPQVYSPQTVTLTALTEGKDSPNARPNSLEMARVVLLNLDGEEKTPDEIRALIKKTYGIGPAKTLDQMLYKRASKGTMFYKTAEGRFGLLALRATTEEVRTPTTAVA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.