Basic Information | |
---|---|
Taxon OID | 3300012359 Open in IMG/M |
Scaffold ID | Ga0137385_10097738 Open in IMG/M |
Source Dataset Name | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2603 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 39.5673 | Long. (o) | -123.4758 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048866 | Metagenome | 147 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137385_100977384 | F048866 | AGGAG | LTVDQNEKPVLLSLDGRGFYVLRYTAIPETNLTRISFELVDPNTGEGASADALVDPKLIQDRNNYNNKPSTGKAFLIWIDTEKGEVSWQLRTKPDIQPLK* |
⦗Top⦘ |