Scaffold Ga0137371_10445671

Overview

Basic Information

• Taxon OID: 3300012356
• Scaffold ID: Ga0137371_10445671
• Source Dataset Name: Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1002
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.5673
  • Long. (^o): -123.4758

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030262	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137371_104456711	F030262	GGA	VATDPKRIELRLDADPCFAAAAGGAVRYLAEASGLPEEVCREFQQDTVRACLDAFESRSIRTHVVELCRFEDRLEVVVDSNAGSAGIRLARPVDSRS*