| Basic Information | |
|---|---|
| Taxon OID | 3300012352 Open in IMG/M |
| Scaffold ID | Ga0157138_1038622 Open in IMG/M |
| Source Dataset Name | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Molecular Research LP (MR DNA) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 755 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Fraserville, Ontario | |||||||
| Coordinates | Lat. (o) | 44.16961 | Long. (o) | -78.4089 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031397 | Metagenome / Metatranscriptome | 182 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0157138_10386221 | F031397 | N/A | MISRLLPLLFAAALFAEAPRPRAGFEGVGVRLTSASASGDGKAEDRATGFEVTGNFPLLKSGSWQYDWGFRYAQTRHEWTAAPVDFDLVRGVSLNLSGYASTEAGRSRYAVLQVNSDAAEGVSFGDALTVQALYGADWRQSETFTLGYLFLAETRAVRSPMVLVVPTFRWQFAPDWSLGTGRKSLVLERKLDEAWRASLTLAFQQEEARLADLAGQRQDYESERVAAL |
| ⦗Top⦘ |