Scaffold Ga0157138_1000131

Overview

Basic Information

• Taxon OID: 3300012352
• Scaffold ID: Ga0157138_1000131
• Source Dataset Name: Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 19668
• Total Scaffold Genes: 30
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 27 (90.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Fraserville, Ontario
• Coordinates
  • Lat. (^o): 44.16961
  • Long. (^o): -78.4089

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081088	Metagenome / Metatranscriptome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157138_100013121	F081088	N/A	MNKLLLNNKPKDSTNEEFVKAWNNSTYVMEALCKTLQSIKDDIGSIKKDDFDCPNHYAKLAYNMGQIKMIDLVISMLPEGAKG*