Scaffold Ga0157141_1003125

Overview

Basic Information

• Taxon OID: 3300012346
• Scaffold ID: Ga0157141_1003125
• Source Dataset Name: Freshwater microbial communities from Emily Creek, Ontario, Canada - S29
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3010
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 6 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location

• Location Name: Kawartha Lake, Ontario
• Coordinates
  • Lat. (^o): 44.46181
  • Long. (^o): -78.6228

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022835	Metagenome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157141_100312510	F022835	N/A	DKMNITNDPKLEEARKQLELTMLGADIEYIKESSMVRENLKNKVDAILQKFEW*