NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0157137_104375

Scaffold Ga0157137_104375


Overview

Basic Information
Taxon OID3300012286 Open in IMG/M
Scaffold IDGa0157137_104375 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Ausable River, Ontario, Canada - S47
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)991
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater → Freshwater Microbial Communities From Rivers And Streams Along An Organic Matter Gradient Associated With Agriculture In Ontario, Canada

Source Dataset Sampling Location
Location NameAilsa Craig, Ontario
CoordinatesLat. (o)43.22713Long. (o)-81.5225Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029558Metagenome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0157137_1043752F029558N/AMKEFLKHIKIGDYVESLIHVLTLGYGARISHWYAVDILGLKSCGCCERKQFLNRLTNPEYDGKCNEVKLF*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.