Basic Information | |
---|---|
Taxon OID | 3300012282 Open in IMG/M |
Scaffold ID | Ga0157136_1007310 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Molecular Research LP (MR DNA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 688 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Ontario, Canada | |||||||
Coordinates | Lat. (o) | 42.097417 | Long. (o) | -82.141111 | Alt. (m) | Depth (m) | 20.5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F028808 | Metagenome / Metatranscriptome | 190 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157136_10073103 | F028808 | N/A | PTGKLQYIADELDKIPIVSSKLYRGMSEKEYNILKSTGKVTSRGRGNTRNIVGSYLASDFKLAARFALVNYRDKREGIVVVIDKSKLPDLKNVDPGNYVTSYIPIESVTKIIDLKKL* |
⦗Top⦘ |