Scaffold Ga0157136_1007288

Overview

Basic Information

• Taxon OID: 3300012282
• Scaffold ID: Ga0157136_1007288
• Source Dataset Name: Freshwater microbial communities from Central Basin Methane Hotpot in Lake Erie, Ontario, Canada - Station 1365 - Bottom - Depth 20.5m
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Molecular Research LP (MR DNA)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 689
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location

• Location Name: Ontario, Canada
• Coordinates
  • Lat. (^o): 42.097417
  • Long. (^o): -82.141111
  • Depth (m): 20.5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018719	Metagenome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0157136_10072881	F018719	N/A	MTPTFNTWDRAVLDKFALEAYLRMLKQQDQLEQLRNDLKDAIEAYRAVMRE*