Scaffold Ga0126329_10019526

Overview

Basic Information

• Taxon OID: 3300012273
• Scaffold ID: Ga0126329_10019526
• Source Dataset Name: Marine gutless worms symbiont microbial communities from Oahu, Hawaii - Inanidrilus sp. 2 OAHU.JWI-85 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3181
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (77.78%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location

• Location Name: Hawaii, USA
• Coordinates
  • Lat. (^o): 21.3935
  • Long. (^o): -157.7156
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080736	Metagenome	114	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126329_100195269	F080736	GGAGG	VLEDLQSSRKRFDLEHCEGDLCWSLSESGGRKERPECHLHNILL*