Basic Information | |
---|---|
Taxon OID | 3300012271 Open in IMG/M |
Scaffold ID | Ga0136555_1025697 Open in IMG/M |
Source Dataset Name | Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Torckler E5 #432 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1331 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Antarctica: Rauer Islands | |||||||
Coordinates | Lat. (o) | -68.5558 | Long. (o) | 78.1913 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F056622 | Metagenome / Metatranscriptome | 137 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136555_10256971 | F056622 | N/A | MDNKNKIHNMASCMLSILDSLKLYDNDSLLLDNETLSEVMFRKMKAYNIDLNKELGFTHLKPISKNEL* |
⦗Top⦘ |