Scaffold Ga0136590_1024431

Overview

Basic Information

• Taxon OID: 3300012268
• Scaffold ID: Ga0136590_1024431
• Source Dataset Name: Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 3 #765
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1141
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Rauer Islands
• Coordinates
  • Lat. (^o): -68.5558
  • Long. (^o): 78.1913

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093010	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0136590_10244311	F093010	AGGAG	MKPCAHLLALARRSIPWFLVSFLLMPLAIPASAQTSCGPMVAIHTALTDQYGEQFYESRADPSAPGGVAELWINHRTGTFTVLVYPQPGVACLVQTGQSDKLISYAA*