Scaffold Ga0136712_1045149

Overview

Basic Information

• Taxon OID: 3300012266
• Scaffold ID: Ga0136712_1045149
• Source Dataset Name: Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 518
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: USA: Indian Creek, Illinois
• Coordinates
  • Lat. (^o): 41.6655
  • Long. (^o): -87.5437

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003439	Metagenome / Metatranscriptome	486	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136712_10451492	F003439	GGA	MTVNNSRSQNDSLNEGATDGKYRKRRPNTEVIPGFGDQTVVQNRADLHPYMNYGFINSEEPSKVNPGK*