| Basic Information | |
|---|---|
| Taxon OID | 3300012266 Open in IMG/M |
| Scaffold ID | Ga0136712_1014871 Open in IMG/M |
| Source Dataset Name | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 852 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Indian Creek, Illinois | |||||||
| Coordinates | Lat. (o) | 41.6655 | Long. (o) | -87.5437 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000716 | Metagenome / Metatranscriptome | 923 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136712_10148711 | F000716 | N/A | MIKMEKLKQDVSHYQLYAGKTYMQYEQDKYSIYQNYLYKRALYGLESLTEKELATICSKKKQRINNVYKRAQTVLNTLKQKLTIKYSNDIFQRFFPNSKMTQDILNYSEIDEKYKNTLTFKDLKVSKDDIIRIFIAEGILPKNFLSLENAP |
| ⦗Top⦘ |