Scaffold Ga0136606_1015921

Overview

Basic Information

• Taxon OID: 3300012262
• Scaffold ID: Ga0136606_1015921
• Source Dataset Name: Saline lake microbial communities from Deep Lake, Antarctica - Metagenome #680
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 822
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Chlorophyta → core chlorophytes → Chlorophyceae → CS clade → Chlamydomonadales → Dunaliellaceae → Dunaliella → Dunaliella tertiolecta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Deep Lake
• Coordinates
  • Lat. (^o): -68.5602
  • Long. (^o): 78.1968

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001038	Metagenome	796	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136606_10159211	F001038	N/A	VSVVDGAAHTQKDDVESNRGSLENVAKVFVLFLCGIQLVLRSGVLTVLDLDKVDVTPRFAEVFRSMLSGVGGSTGGWGCC*