Basic Information | |
---|---|
Taxon OID | 3300012212 Open in IMG/M |
Scaffold ID | Ga0150985_102225857 Open in IMG/M |
Source Dataset Name | Combined assembly of Hopland grassland soil |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1222 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere → Avena Fatua Rhizosphere Microbial Communities From Hopland, California, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Hopland, California, USA | |||||||
Coordinates | Lat. (o) | 38.972988 | Long. (o) | -123.116539 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082253 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0150985_1022258573 | F082253 | GGA | MGMKASEVGDWLRQCAGKRDHREVLSDDVVVIRPGPNFDWFMGNLGADQPAPRAPEHRKSSEDRREAGDRLG* |
⦗Top⦘ |