Scaffold Ga0137377_11309965

Overview

Basic Information

• Taxon OID: 3300012211
• Scaffold ID: Ga0137377_11309965
• Source Dataset Name: Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 654
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 39.5673
  • Long. (^o): -123.4758

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012142	Metagenome / Metatranscriptome	283	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137377_113099653	F012142	GAGG	MLFRGFVLFARNAGGKFGKVFKEKSGMLFRRFVLFVRNVGRNRENDNKGELRPKFEWPYVMSSFVAMRGPLVSGTWIWH