NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137365_10000803

Scaffold Ga0137365_10000803


Overview

Basic Information
Taxon OID3300012201 Open in IMG/M
Scaffold IDGa0137365_10000803 Open in IMG/M
Source Dataset NameVadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22747
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (46.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.5673Long. (o)-123.4758Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000399Metagenome / Metatranscriptome1182Y
F011906Metagenome / Metatranscriptome286N
F072313Metagenome / Metatranscriptome121N

Sequences

Protein IDFamilyRBSSequence
Ga0137365_1000080319F072313N/AMPVGAPDELSAVLLAERLARDRGRIDQQSNDSGYLEFNRPPPTPGPAAELLAGVRCWLAEERIAQTIVWIGE*
Ga0137365_1000080324F011906N/AVDAVDRFREQAAIGADKPREVYPPLFEALNWAHSLWDTWFRLVEPQDRHLDGLRHVRDRCHHQVASAIYPDAAAPGGWLWCAIGHLPPEDPGRGHDREGAKNYTELLAQRPVLETLEIVERHFRSIVPDHEL*
Ga0137365_1000080325F000399AGGGGGMAATVTPSLVQQFASMKPADFGRTIEPKWQVAQRLVKEIQGAVEKEHLTPLDGARMISAVAATLFGYDEFILREISPETLLATAPSRR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.