| Basic Information | |
|---|---|
| Taxon OID | 3300012188 Open in IMG/M |
| Scaffold ID | Ga0136618_10052953 Open in IMG/M |
| Source Dataset Name | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ330 (21.06) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1795 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Dry Valley | |||||||
| Coordinates | Lat. (o) | -78.059 | Long. (o) | 163.688 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F038495 | Metagenome | 165 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136618_100529534 | F038495 | AGGA | VAIDQQRRLRQASAQAHTAQDHGDHAGANDAWRRYVLIEDALRDPQDLLDEGVALSKVAIDLWLQR* |
| ⦗Top⦘ |