Scaffold Ga0153922_1100379

Overview

Basic Information

• Taxon OID: 3300012181
• Scaffold ID: Ga0153922_1100379
• Source Dataset Name: Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ006 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 659
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Thermotogae → Thermotogae → Thermotogales → Fervidobacteriaceae → Thermosipho → Thermosipho melanesiensis (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Brendon T. Byrne State Forest
• Coordinates
  • Lat. (^o): 39.9181
  • Long. (^o): -74.5218

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103705	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153922_11003791	F103705	N/A	MAHHIFRLKSELQNIPEAAPEAAPSFSVSEKLARYGSFALSGVEHLTLIVGKESVTLALIRHFGSLKAMARASFQELRQFLPRRQAESVVAALSMSVVAETEHTCAEQLDNPESIYRACADMKLFNQEVLRVILLDTRFRSRWSPICFAACSWNICSKP