Scaffold Ga0153974_1099696

Overview

Basic Information

• Taxon OID: 3300012180
• Scaffold ID: Ga0153974_1099696
• Source Dataset Name: Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 659
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia, Yuchi Wildlife Management Area
• Coordinates
  • Lat. (^o): 33.0837
  • Long. (^o): -81.7708

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046130	Metagenome	151	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153974_10996962	F046130	N/A	SSEIRGGALNPDAEWNAMMAAGIIYALPPIVLLLVLRRHVTASLAMVSAGI*