NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153974_1023649

Scaffold Ga0153974_1023649


Overview

Basic Information
Taxon OID3300012180 Open in IMG/M
Scaffold IDGa0153974_1023649 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1323
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: Georgia, Yuchi Wildlife Management Area
CoordinatesLat. (o)33.0837Long. (o)-81.7708Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017502Metagenome / Metatranscriptome240N

Sequences

Protein IDFamilyRBSSequence
Ga0153974_10236491F017502AGGAGMDKQAWSRQAIVAAAAVALAAAVPLTMKAHAYPFGHRIGGYQVTTGADGGSTVDKAAPTDDGSIIIECVGFDGRMMPYANEADTASTLHAVSMPQHSLGPSKCWSGEHKRSAGG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.