Scaffold Ga0153952_1081290

Overview

Basic Information

• Taxon OID: 3300012176
• Scaffold ID: Ga0153952_1081290
• Source Dataset Name: Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ036 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 711
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Wharton State Forest
• Coordinates
  • Lat. (^o): 39.746
  • Long. (^o): -74.7609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030810	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153952_10812901	F030810	GGAG	MTRLVGPRGLSVLIFVGLVALALAVVGWYQRDNGVVGPLPNYSSMQIAIHAAGGGIAG*