NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0153939_1055368

Scaffold Ga0153939_1055368


Overview

Basic Information
Taxon OID3300012162 Open in IMG/M
Scaffold IDGa0153939_1055368 Open in IMG/M
Source Dataset NameAttine ant fungus gardens microbial communities from New Jersey, USA - TSNJ023 MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)745
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location NameUSA: New Jersey, Brendan T. Byrne State Forest
CoordinatesLat. (o)39.873Long. (o)-74.5232Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023497Metagenome209Y

Sequences

Protein IDFamilyRBSSequence
Ga0153939_10553683F023497N/AVDRGRGGDRICYVCEKWGYMAKNCWERHKGRVVETLQELAKENGGQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.