| Basic Information | |
|---|---|
| Taxon OID | 3300012141 Open in IMG/M |
| Scaffold ID | Ga0153958_1005187 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL042 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3624 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (42.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Leucoagaricus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida, Wekiwa Springs | |||||||
| Coordinates | Lat. (o) | 28.709 | Long. (o) | -81.4873 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000523 | Metagenome | 1050 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0153958_10051873 | F000523 | N/A | VIAKPERRLQRTDKDIGAENDFLNDLGFNLCVAPQSPVVRLVAYFGVMEVVKTEVLSVQVEELEGIRYD* |
| ⦗Top⦘ |