Scaffold Ga0153976_1032260

Overview

Basic Information

• Taxon OID: 3300012124
• Scaffold ID: Ga0153976_1032260
• Source Dataset Name: Attine ant fungus gardens microbial communities from Georgia, USA - TSGA060 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 776
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Rosales → Rosaceae → Amygdaloideae → Amygdaleae → Prunus → Prunus persica (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: Georgia, Yuchi Wildlife Management Area
• Coordinates
  • Lat. (^o): 33.0837
  • Long. (^o): -81.7707

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050060	Metagenome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0153976_10322601	F050060	N/A	LADFITKLPLAQGYDAILVVCNCFSKMAHFIATMEKTSAKGLAKLF*