| Basic Information | |
|---|---|
| Taxon OID | 3300012112 Open in IMG/M |
| Scaffold ID | Ga0154004_1006846 Open in IMG/M |
| Source Dataset Name | Attine ant fungus gardens microbial communities from Florida, USA - TSFL088 MetaG |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1903 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales → Phanerochaetaceae → Phanerodontia → Phanerodontia chrysosporium | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Florida, Lake Talquin State Forest | |||||||
| Coordinates | Lat. (o) | 30.4397 | Long. (o) | -84.4952 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053688 | Metagenome | 140 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0154004_10068461 | F053688 | N/A | YGGQVLGRDTSFVQAVYPLSLTDSEVPFTARARYPKGLRVLYSLARRSVE* |
| ⦗Top⦘ |