Scaffold Ga0154008_115120

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0154008_115120

Scaffold Ga0154008_115120

Overview

Basic Information
Taxon OID	3300012100 Open in IMG/M
Scaffold ID	Ga0154008_115120 Open in IMG/M
Source Dataset Name	Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ092 MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	758
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location
Location Name	USA: Connecticut, Klassen Lab
Coordinates	Lat. (^o)	41.8102	Long. (^o)	-72.2564	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104171	Metagenome	100	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0154008_1151202	F104171	N/A	PLLLKEHSVDLLLQGHNHGKELFLSGLGGGWVLKGVLSIAVVVGETLVMVMVMLMFPRRRMNGLLCLYL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.