| Basic Information | |
|---|---|
| Taxon OID | 3300012094 Open in IMG/M |
| Scaffold ID | Ga0136638_10430821 Open in IMG/M |
| Source Dataset Name | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ858 (22.06) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 623 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Antarctica: Dry Valley | |||||||
| Coordinates | Lat. (o) | -78.0741 | Long. (o) | 163.8918 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009385 | Metagenome / Metatranscriptome | 318 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136638_104308211 | F009385 | N/A | LERAIAKALKIRPRVEFDRFGRYRVSGSKGYYTVVCRKDERGYKTVACTCKGAEKGLVCYHSAAALSLHIGLARRQQAA* |
| ⦗Top⦘ |