Scaffold Ga0136632_10132015

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136632_10132015

Scaffold Ga0136632_10132015

Overview

Basic Information
Taxon OID	3300012093 Open in IMG/M
Scaffold ID	Ga0136632_10132015 Open in IMG/M
Source Dataset Name	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1151
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location Name	Antarctica: Dry Valley
Coordinates	Lat. (^o)	-78.1266	Long. (^o)	163.9666	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023493	Metagenome / Metatranscriptome	210	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136632_101320153	F023493	GGAG	MTIKELEQIEDRARRGLPIDPELILTLTAYLRNVLQEKINAEAVASEALKKAGLKSRYHTRAA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.