Scaffold Ga0136632_10006254

Overview

Basic Information

• Taxon OID: 3300012093
• Scaffold ID: Ga0136632_10006254
• Source Dataset Name: Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4769
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location

• Location Name: Antarctica: Dry Valley
• Coordinates
  • Lat. (^o): -78.1266
  • Long. (^o): 163.9666

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036980	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136632_100062542	F036980	N/A	LRSGLKTLIEEMVMANNGSEESKDMLFLVGGFALLVAGAGLIMAHPEIRKQVRVGLDRVLPGIQDNFNLGLTTVVPDFQRYMKIRSM*