Scaffold Ga0153924_1098815

Overview

Basic Information

• Taxon OID: 3300012089
• Scaffold ID: Ga0153924_1098815
• Source Dataset Name: Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ008 MetaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 589
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens → Attine Ant Fungus Gardens Microbial Communities From Various Locations In Usa

Source Dataset Sampling Location

• Location Name: USA: New Jersey, Wharton State Forest
• Coordinates
  • Lat. (^o): 39.7086
  • Long. (^o): -74.664

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030163	Metagenome / Metatranscriptome	186	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0153924_10988152	F030163	GGAGG	MAKVSLSRRRTKRRHAREKATIDHLVRAVFEKTKGTVHAPFTLSGLSVEEQIRKEWHPGMGGLALF*